FBXO11 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2120875
| Article Name: |
FBXO11 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2120875 |
| Supplier Catalog Number: |
orb2120875 |
| Alternative Catalog Number: |
BYT-ORB2120875-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
ChIP, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human FBXO11 |
| Conjugation: |
Biotin |
| Alternative Names: |
UBR6, VIT1, FBX11, PRMT9, IDDFBA, UG063H01 |
| FBXO11 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
94kDa |
| NCBI: |
079409 |
| UniProt: |
Q6DF73 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: HDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQ |
