MARCH7 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2120911
Article Name: MARCH7 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2120911
Supplier Catalog Number: orb2120911
Alternative Catalog Number: BYT-ORB2120911-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MARCH7
Conjugation: Biotin
Alternative Names: AXO, AXOT, MARCH7, RNF177, MARCH-VII
MARCH7 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 78kDa
NCBI: 073737
UniProt: Q9H992
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SSMSSTFFSRRSSQDSLNTRSLNSENSYVSPRILTASQSRSNVPSASEVP