RNF20 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2120956
Article Name: RNF20 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2120956
Supplier Catalog Number: orb2120956
Alternative Catalog Number: BYT-ORB2120956-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RNF20
Conjugation: Biotin
Alternative Names: BRE1, BRE1A, hBRE1
RNF20 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 114kDa
NCBI: 062538
UniProt: Q5VTR2
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LKRYDLEQGLGDLLTERKALVVPEPEPDSDSNQERKDDRERGEGQEPAFS