RNF186 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2120962
Article Name: RNF186 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2120962
Supplier Catalog Number: orb2120962
Alternative Catalog Number: BYT-ORB2120962-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RNF186
Conjugation: Biotin
Alternative Names: FLJ20225, RP11-91K11.1
RNF186 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 24kDa
NCBI: 061935
UniProt: Q9NXI6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MACTKTLQQSQPISAGATTTTTAVAPAGGHSGSTECDLECLVCREPYSCP