CHFR Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2120974
Article Name: CHFR Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2120974
Supplier Catalog Number: orb2120974
Alternative Catalog Number: BYT-ORB2120974-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CHFR
Conjugation: Biotin
Alternative Names: RNF116, RNF196
CHFR Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 69kDa
NCBI: 060693
UniProt: Q96EP1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: REWTIGRRRGCDLSFPSNKLVSGDHCRIVVDEKSGQVTLEDTSTSGTVIN