PDZRN4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2121142
Article Name: PDZRN4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2121142
Supplier Catalog Number: orb2121142
Alternative Catalog Number: BYT-ORB2121142-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PDZRN4
Conjugation: Biotin
Alternative Names: LNX4, SAMCAP3L
PDZRN4 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 89kDa
NCBI: 037509
UniProt: B4DG65
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SDSCHSLHPMEHEFYEDNEYISSLPADADRTEDFEYEEVELCRVSSQEKL