FBXW11 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2121154
Article Name: FBXW11 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2121154
Supplier Catalog Number: orb2121154
Alternative Catalog Number: BYT-ORB2121154-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FBXW11
Conjugation: Biotin
Alternative Names: Hos, BTRC2, FBW1B, Fbw11, BTRCP2, FBXW1B, NEDJED
FBXW11 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 62kDa
NCBI: 036432
UniProt: Q9UKB1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: CLQSMPSVRCLQISNGTSSVIVSRKRPSEGNYQKEKDLCIKYFDQWSESD