FBXO4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2121163
Article Name: FBXO4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2121163
Supplier Catalog Number: orb2121163
Alternative Catalog Number: BYT-ORB2121163-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FBXO4
Conjugation: Biotin
Alternative Names: FBX4
FBXO4 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 44kDa
NCBI: 036308
UniProt: Q9UKT5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KRMPCFYLAHELHLNLLNHPWLVQDTEAETLTGFLNGIEWILEEVESKRA