RFFL Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2121376
Article Name: RFFL Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2121376
Supplier Catalog Number: orb2121376
Alternative Catalog Number: BYT-ORB2121376-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RFFL
Conjugation: Biotin
Alternative Names: CARP2, FRING, CARP-2, RNF189, RNF34L, RIFIFYLIN
RFFL Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 40kDa
NCBI: 001017368
UniProt: Q8WZ73
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KDQKGLQHLVSGAEDQNGGAVPSGLEENLCKICMDSPIDCVLLECGHMVT