RFPL4B Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2121383
Article Name: RFPL4B Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2121383
Supplier Catalog Number: orb2121383
Alternative Catalog Number: BYT-ORB2121383-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RFPL4B
Conjugation: HRP
Alternative Names: RNF211
RFPL4B Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 30kDa
NCBI: 001013756
UniProt: Q6ZWI9
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: MTKQHNSRLEQSLHVREELRHFREDVTLDAATASSLLVFSNDLRSAQCKK