TBXA2R Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2121386
Article Name: TBXA2R Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2121386
Supplier Catalog Number: orb2121386
Alternative Catalog Number: BYT-ORB2121386-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human TBXA2R
Conjugation: HRP
Alternative Names: TXA2-R, BDPLT13
TBXA2R Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 54kDa
NCBI: 001051
UniProt: P21731
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: EYSGAISAHCNLRLPGSSDSSASACQVAGTTGTRPSWMQPPCLPSRWWAS