TBXA2R Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2121387
Article Name: TBXA2R Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2121387
Supplier Catalog Number: orb2121387
Alternative Catalog Number: BYT-ORB2121387-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human TBXA2R
Conjugation: FITC
Alternative Names: TXA2-R, BDPLT13
TBXA2R Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 54kDa
NCBI: 001051
UniProt: P21731
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: EYSGAISAHCNLRLPGSSDSSASACQVAGTTGTRPSWMQPPCLPSRWWAS