RCHY1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2121392
Article Name: RCHY1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2121392
Supplier Catalog Number: orb2121392
Alternative Catalog Number: BYT-ORB2121392-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RCHY1
Conjugation: HRP
Alternative Names: ZCHY, ARNIP, CHIMP, PIRH2, RNF199, ZNF363, PRO1996
RCHY1 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 23kDa
NCBI: 001008925
UniProt: Q96PM5
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: KLYTCRLCHDNNEDHQLDRFKVKEVQCINCEKIQHAQQTCEECSTLFGEY