TRIM67 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2121418
Article Name: TRIM67 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2121418
Supplier Catalog Number: orb2121418
Alternative Catalog Number: BYT-ORB2121418-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TRIM67
Conjugation: Biotin
Alternative Names: TNL
TRIM67 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 84kDa
NCBI: 001004342
UniProt: Q6ZTA4
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GGVCKGATVGVLLDLNKHTLTFFINGQQQGPTAFSHVDGVFMPALSLNRN