TJAP1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2121474
Article Name: TJAP1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2121474
Supplier Catalog Number: orb2121474
Alternative Catalog Number: BYT-ORB2121474-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TJAP1
Conjugation: FITC
Alternative Names: PILT, TJP4
TJAP1 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 61kDa
NCBI: 542171
UniProt: Q5JTD0
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: PGTSHTEGRAWPLPSSSRPQRSPKRMGVHHLHRKDSLTQAQEQGNLLN