GTPBP10 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2121485
Article Name: GTPBP10 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2121485
Supplier Catalog Number: orb2121485
Alternative Catalog Number: BYT-ORB2121485-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GTPBP10
Conjugation: HRP
Alternative Names: ObgH2, UG0751c10
GTPBP10 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 43kDa
NCBI: 149098
UniProt: A4D1E9
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: DLKLIADVGLVGFPNAGKSSLLSCVSHAKPAIADYAFTTLKPELGKIMYS