Gje1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2121564
Article Name: Gje1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2121564
Supplier Catalog Number: orb2121564
Alternative Catalog Number: BYT-ORB2121564-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
Conjugation: FITC
Alternative Names: Cx29, Gje1, Cxnp1
Gje1 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 30kDa
NCBI: 536698
UniProt: Q921C1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GFRLLILVSSGPGVFGNDENEFICHLGQPGCKTICYDVFRPLSPLRFWAF