Rgs18 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2121578
Article Name: Rgs18 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2121578
Supplier Catalog Number: orb2121578
Alternative Catalog Number: BYT-ORB2121578-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
Conjugation: HRP
Alternative Names: MGC117531
Rgs18 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 27kDa
NCBI: 075019
UniProt: Q99PG4
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: AKEKRNRLSLLLQRPDFHGETQASRSALLAKETRVSPEEAVKWAESFDKL