CLDN2 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2121585
Article Name: CLDN2 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2121585
Supplier Catalog Number: orb2121585
Alternative Catalog Number: BYT-ORB2121585-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CLDN2
Conjugation: FITC
Alternative Names: OAZON
CLDN2 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 24kDa
NCBI: 065117
UniProt: P57739
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: WMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAMSSLACIISVV