Rgs1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2121590
Article Name: Rgs1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2121590
Supplier Catalog Number: orb2121590
Alternative Catalog Number: BYT-ORB2121590-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
Conjugation: HRP
Alternative Names: BL3, BL34
Rgs1 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 23kDa
NCBI: 056626
UniProt: Q9JL25
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: MRAAAISMPRLNKMPGMFFSASPKDSKEHSHSLLDDKKQKKRPKTFGMDV