ABP1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2122994
Article Name: ABP1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2122994
Supplier Catalog Number: orb2122994
Alternative Catalog Number: BYT-ORB2122994-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ABP1
Conjugation: HRP
Alternative Names: ABP, DAO, KAO, ABP1, DAO1
ABP1 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 83kDa
NCBI: 001082
UniProt: P19801
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: QFLHNNENIENEDLVAWVTVGFLHIPHSEDIPNTATPGNSVGFLLRPFNF