ABP1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2122995
Article Name: ABP1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2122995
Supplier Catalog Number: orb2122995
Alternative Catalog Number: BYT-ORB2122995-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ABP1
Conjugation: FITC
Alternative Names: ABP, DAO, KAO, ABP1, DAO1
ABP1 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 83kDa
NCBI: 001082
UniProt: P19801
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: QFLHNNENIENEDLVAWVTVGFLHIPHSEDIPNTATPGNSVGFLLRPFNF