UGT2B15 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2122997
Article Name: UGT2B15 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2122997
Supplier Catalog Number: orb2122997
Alternative Catalog Number: BYT-ORB2122997-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human UGT2B15
Conjugation: HRP
Alternative Names: HLUG4, UGT2B8, UDPGTH3, UDPGT 2B8, UDPGT2B15
UGT2B15 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 61kDa
NCBI: 001067
UniProt: P54855
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: IKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYY