ACSL6 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2123094
Article Name: ACSL6 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2123094
Supplier Catalog Number: orb2123094
Alternative Catalog Number: BYT-ORB2123094-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ACSL6
Conjugation: FITC
Alternative Names: ACS2, FACL6, LACS2, LACS5, LACS 6
ACSL6 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 68kDa
NCBI: 056071
UniProt: Q9UKU0
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SGLHSFEQVKAIHIHSDMFSVQNGLLTPTLKAKRPELREYFKKQIEELYS