EEF1AKNMT Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2123097
Article Name: EEF1AKNMT Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2123097
Supplier Catalog Number: orb2123097
Alternative Catalog Number: BYT-ORB2123097-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human KIAA0859
Conjugation: FITC
Alternative Names: feat, DFNM1, CGI-01, DFNB26, DFNB26M, METTL13, KIAA0859, 5630401D24Rik
EEF1AKNMT Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 60kDa
NCBI: 001007240
UniProt: Q8N6R0
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: NEILFCQLHPEQKLATPELLETAQALERTLRKPGRGWDDTYVLSDMLKTV