C4B Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Catalog Number:
BYT-ORB2123112
| Article Name: |
C4B Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2123112 |
| Supplier Catalog Number: |
orb2123112 |
| Alternative Catalog Number: |
BYT-ORB2123112-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human C4B |
| Conjugation: |
FITC |
| Alternative Names: |
C4A, C4F, CO4, C4B1, C4B2, C4B3, C4B5, C4A91, C4B12 |
| C4B Rabbit Polyclonal Antibody (FITC) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
193kDa |
| NCBI: |
001002029 |
| UniProt: |
Q6U2E9 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: QTDQPIYNPGQRVRYRVFALDQKMRPSTDTITVMVENSHGLRVRKKEVYM |
