HSD17B6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2123608
Article Name: HSD17B6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2123608
Supplier Catalog Number: orb2123608
Alternative Catalog Number: BYT-ORB2123608-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HSD17B6
Conjugation: Biotin
Alternative Names: HSE, RODH, SDR9C6
HSD17B6 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 35kDa
NCBI: 003716
UniProt: O14756
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLD