FCN3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2123611
Article Name: FCN3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2123611
Supplier Catalog Number: orb2123611
Alternative Catalog Number: BYT-ORB2123611-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FCN3
Conjugation: Biotin
Alternative Names: FCNH, HAKA1
FCN3 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 31kDa
NCBI: 003656
UniProt: O75636
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGDPVNLL