SFTPC Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2123629
Article Name: SFTPC Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2123629
Supplier Catalog Number: orb2123629
Alternative Catalog Number: BYT-ORB2123629-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SFTPC
Conjugation: Biotin
Alternative Names: SP5, SP-C, PSP-C, SFTP2, SMDP2, BRICD6
SFTPC Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 21kDa
NCBI: 003009
UniProt: P11686
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MDVGSKEVLMESPPDYSAAPRGRFGIPCCPVHLKRLLIVVVVVVLIVVVI