GPX3 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2123660
Article Name: GPX3 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2123660
Supplier Catalog Number: orb2123660
Alternative Catalog Number: BYT-ORB2123660-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GPX3
Conjugation: HRP
Alternative Names: GPx-P, GSHPx-3, GSHPx-P
GPX3 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 25kDa
NCBI: 002075
UniProt: P22352
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: DCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYI