FN1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2123664
Article Name: FN1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2123664
Supplier Catalog Number: orb2123664
Alternative Catalog Number: BYT-ORB2123664-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FN1
Conjugation: FITC
Alternative Names: FN, CIG, FNZ, MSF, ED-B, FINC, GFND, LETS, GFND2, SMDCF
FN1 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 76kDa
NCBI: 70534
UniProt: P02751
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: NCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADR