FN1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2123666
Article Name: FN1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2123666
Supplier Catalog Number: orb2123666
Alternative Catalog Number: BYT-ORB2123666-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FN1
Conjugation: HRP
Alternative Names: FN, CIG, FNZ, MSF, ED-B, FINC, GFND, LETS, GFND2, SMDCF
FN1 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 71kDa
NCBI: 473375
UniProt: Q564H7
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: GNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMI