CYP1A1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2123832
Article Name: CYP1A1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2123832
Supplier Catalog Number: orb2123832
Alternative Catalog Number: BYT-ORB2123832-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CYP1A1
Conjugation: FITC
Alternative Names: AHH, AHRR, CP11, CYP1, CYPIA1, P1-450, P450-C, P450DX
CYP1A1 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 58kDa
NCBI: 000490
UniProt: P04798
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: FKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANV