SERPINC1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2123839
Article Name: SERPINC1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2123839
Supplier Catalog Number: orb2123839
Alternative Catalog Number: BYT-ORB2123839-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SERPINC1
Conjugation: Biotin
Alternative Names: AT3, AT3D, ATIII, THPH7, ATIII-R2, ATIII-T1, ATIII-T2
SERPINC1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 52kDa
NCBI: 000479
UniProt: P01008
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: ISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFNETYQD