MAT1A Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2123850
Article Name: MAT1A Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2123850
Supplier Catalog Number: orb2123850
Alternative Catalog Number: BYT-ORB2123850-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MAT1A
Conjugation: FITC
Alternative Names: MAT, SAMS, MATA1, SAMS1
MAT1A Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 43kDa
NCBI: 000420
UniProt: Q00266
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: TSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGE