TNNI3 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2123862
Article Name: TNNI3 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2123862
Supplier Catalog Number: orb2123862
Alternative Catalog Number: BYT-ORB2123862-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TNNI3
Conjugation: FITC
Alternative Names: CMH7, RCM1, cTnI, CMD2A, TNNC1, CMD1FF
TNNI3 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 23kDa
NCBI: 000354
UniProt: Q59H18
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: RVRISADAMMQALLGARAKESLDLRAHLKQVKKEDTEKENREVGDWRKNI