PAPOLB Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2124649
Article Name: PAPOLB Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2124649
Supplier Catalog Number: orb2124649
Alternative Catalog Number: BYT-ORB2124649-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PAPOLB
Conjugation: Biotin
Alternative Names: PAPT, TPAP
PAPOLB Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 72kDa
NCBI: 064529
UniProt: A4D1Z6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: TDCLLTQRLIETLRPFGVFEEEEELQRRILVLEKLNNLVKEWIREISESK