RBM38 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2124760
Article Name: RBM38 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2124760
Supplier Catalog Number: orb2124760
Alternative Catalog Number: BYT-ORB2124760-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RBM38
Conjugation: Biotin
Alternative Names: RNPC1, SEB4B, SEB4D, HSRNASEB, dJ800J21.2
RBM38 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 25kDa
NCBI: 059965
UniProt: Q9H0Z9
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: QYPYAASPATAASFVGYSYPAAVPQALSAAAPAGTTFVQYQAPQLQPDRM