CPSF3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2124796
Article Name: CPSF3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2124796
Supplier Catalog Number: orb2124796
Alternative Catalog Number: BYT-ORB2124796-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CPSF3
Conjugation: Biotin
Alternative Names: CPSF73, CPSF-73
CPSF3 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 75kDa
NCBI: 057291
UniProt: Q9UKF6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: DDSILSVTVDGKTANLNLETRTVECEEGSEDDESLREMVELAAQRLYEAL