RBM34 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2124868
Article Name: RBM34 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2124868
Supplier Catalog Number: orb2124868
Alternative Catalog Number: BYT-ORB2124868-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human RBM34
Conjugation: Biotin
Alternative Names: KIAA0117
RBM34 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 48kDa
NCBI: 055829
UniProt: A8K8J7
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SKPKQGLNFTSKTAEGHPKSLFIGEKAVLLKTKKKGQKKSGRPKKQRKQK