STAU2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2124919
Article Name: STAU2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2124919
Supplier Catalog Number: orb2124919
Alternative Catalog Number: BYT-ORB2124919-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human STAU2
Conjugation: Biotin
Alternative Names: 39K2, 39K3
STAU2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 34kDa
UniProt: Q9NUL3
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: AMLLQLGYKASTNLQDQLEKTGENKGWSGPKPGFPEPTNNTPKGILHLSP