XPOT Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2125018
Article Name: XPOT Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2125018
Supplier Catalog Number: orb2125018
Alternative Catalog Number: BYT-ORB2125018-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human XPOT
Conjugation: Biotin
Alternative Names: XPO3
XPOT Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 110kDa
NCBI: 009166
UniProt: O43592
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: TVLSDQQKANVEAIMLAVMKKLTYDEEYNFENEGEDEAMFVEYRKQLKLL