U1SNRNPBP Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2125039
Article Name: U1SNRNPBP Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2125039
Supplier Catalog Number: orb2125039
Alternative Catalog Number: BYT-ORB2125039-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human U1SNRNPBP
Conjugation: Biotin
Alternative Names: HM-1, U1SNRNPBP
U1SNRNPBP Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 28kDa
NCBI: 851034
UniProt: Q5XKN9
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: RAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEVFSRYGDIR