SARS Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2125120
Article Name: SARS Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2125120
Supplier Catalog Number: orb2125120
Alternative Catalog Number: BYT-ORB2125120-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SARS
Conjugation: Biotin
Alternative Names: SARS, SERS, SERRS, NEDMAS
SARS Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 57kDa
NCBI: 006504
UniProt: Q5T5C8
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDL