SFRS9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2125495
Article Name: SFRS9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2125495
Supplier Catalog Number: orb2125495
Alternative Catalog Number: BYT-ORB2125495-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SFRS9
Conjugation: Biotin
Alternative Names: SFRS9, SRp30c
SFRS9 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 25kDa
NCBI: 003760
UniProt: Q13242
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPER