EIF3G Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2125507
Article Name: EIF3G Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2125507
Supplier Catalog Number: orb2125507
Alternative Catalog Number: BYT-ORB2125507-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, IP, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EIF3G
Conjugation: Biotin
Alternative Names: EIF3S4, EIF3-P42, eIF3-p44, eIF3-delta
EIF3G Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 35kDa
NCBI: 003746
UniProt: O75821
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISR