SRP19 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2125585
Article Name: SRP19 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2125585
Supplier Catalog Number: orb2125585
Alternative Catalog Number: BYT-ORB2125585-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SRP19
Conjugation: Biotin
SRP19 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 16kDa
NCBI: 003126
UniProt: P09132
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: CLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKKK