SNRPN Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2125594
Article Name: SNRPN Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2125594
Supplier Catalog Number: orb2125594
Alternative Catalog Number: BYT-ORB2125594-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SNRPN
Conjugation: Biotin
Alternative Names: SMN, PWCR, SM-D, sm-N, RT-LI, HCERN3, SNRNP-N, SNURF-SNRPN
SNRPN Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 24kDa
NCBI: 003088
UniProt: P63162
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: DEFRKIKPKNAKQPEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARV