Auh Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2125756
Article Name: Auh Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2125756
Supplier Catalog Number: orb2125756
Alternative Catalog Number: BYT-ORB2125756-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
Conjugation: Biotin
Alternative Names: C77140, W91705
Auh Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 33kDa
NCBI: 057918
UniProt: Q9JLZ3
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: PRRGYSSEVKTEDELRVRHLEEENRGIVVLGINRAYGKNALSKNLLKMLS