HNRPL Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2125768
Article Name: HNRPL Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2125768
Supplier Catalog Number: orb2125768
Alternative Catalog Number: BYT-ORB2125768-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IF, IHC, IP, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HNRPL
Conjugation: Biotin
Alternative Names: HNRPL, hnRNP-L, P/OKcl.14
HNRPL Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 65kDa
NCBI: 001524
UniProt: P14866
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: AAGGGGGGENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYV